Anti EBF2 pAb (ATL-HPA055101)

Atlas Antibodies

Catalog No.:
ATL-HPA055101-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: early B cell factor 2
Gene Name: EBF2
Alternative Gene Name: COE2, FLJ11500
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022053: 100%, ENSRNOG00000011548: 100%
Entrez Gene ID: 64641
Uniprot ID: Q9HAK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPF
Gene Sequence PGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPF
Gene ID - Mouse ENSMUSG00000022053
Gene ID - Rat ENSRNOG00000011548
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EBF2 pAb (ATL-HPA055101)
Datasheet Anti EBF2 pAb (ATL-HPA055101) Datasheet (External Link)
Vendor Page Anti EBF2 pAb (ATL-HPA055101) at Atlas Antibodies

Documents & Links for Anti EBF2 pAb (ATL-HPA055101)
Datasheet Anti EBF2 pAb (ATL-HPA055101) Datasheet (External Link)
Vendor Page Anti EBF2 pAb (ATL-HPA055101)