Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042666-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GAPDHS
Alternative Gene Name: GAPD2, GAPDH-2, GAPDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061099: 75%, ENSRNOG00000021009: 75%
Entrez Gene ID: 26330
Uniprot ID: O14556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS |
Gene Sequence | KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS |
Gene ID - Mouse | ENSMUSG00000061099 |
Gene ID - Rat | ENSRNOG00000021009 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) | |
Datasheet | Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) | |
Datasheet | Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) |
Citations for Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) – 2 Found |
Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. PubMed |
Wu, Huan; Liu, Yiyuan; Li, Yuqian; Li, Kuokuo; Xu, Chuan; Gao, Yang; Lv, Mingrong; Guo, Rui; Xu, Yuping; Zhou, Ping; Wei, Zhaolian; Hua, Rong; He, Xiaojin; Cao, Yunxia. DNALI1 deficiency causes male infertility with severe asthenozoospermia in humans and mice by disrupting the assembly of the flagellar inner dynein arms and fibrous sheath. Cell Death & Disease. 2023;14(2):127. PubMed |