Anti PABPC4 pAb (ATL-HPA056496 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056496-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: poly(A) binding protein, cytoplasmic 4 (inducible form)
Gene Name: PABPC4
Alternative Gene Name: APP-1, iPABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011257: 98%, ENSRNOG00000015642: 100%
Entrez Gene ID: 8761
Uniprot ID: Q13310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNP
Gene Sequence QYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNP
Gene ID - Mouse ENSMUSG00000011257
Gene ID - Rat ENSRNOG00000015642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PABPC4 pAb (ATL-HPA056496 w/enhanced validation)
Datasheet Anti PABPC4 pAb (ATL-HPA056496 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PABPC4 pAb (ATL-HPA056496 w/enhanced validation)