Anti TACSTD2 pAb (ATL-HPA055067 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055067-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: tumor-associated calcium signal transducer 2
Gene Name: TACSTD2
Alternative Gene Name: EGP-1, GA733-1, M1S1, TROP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051397: 81%, ENSRNOG00000007740: 81%
Entrez Gene ID: 4070
Uniprot ID: P09758
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL
Gene Sequence AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL
Gene ID - Mouse ENSMUSG00000051397
Gene ID - Rat ENSRNOG00000007740
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti TACSTD2 pAb (ATL-HPA055067 w/enhanced validation)
Datasheet Anti TACSTD2 pAb (ATL-HPA055067 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TACSTD2 pAb (ATL-HPA055067 w/enhanced validation)



Citations for Anti TACSTD2 pAb (ATL-HPA055067 w/enhanced validation) – 1 Found
Guan, Qing; Wang, Yunjun; Liao, Tian; Guo, Kai; Wen, Duo; Wang, Yu; Xiang, Jun; Wu, Yi. Overexpression of trophoblast cell surface antigen 2 is associated with BRAF V600E mutation and aggressive behavior in papillary thyroid cancer. International Journal Of Clinical And Experimental Pathology. 11(8):4130-4139.  PubMed